PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g034220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 1120aa    MW: 127018 Da    PI: 10.1186
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g034220.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.95.7e-161499195
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk l     ++++ l +p  f++++ +g + ++kt +l++  sg +W vk+  ++ +    lt+GW++F++a++L++gD+vvF+++g++ f  +v+
  Csa17g034220.1 14 FFKPL--LPGFRTH-LDIPVAFFSKYvEGRNDQNKTAKLRSdASGITWLVKM--DGLK----LTDGWEDFASAHDLRTGDIVVFRHEGEMVF--HVT 99
                    66777..6677777.99**********77778999****9989*********..6666....***********************9998888..665 PP

2B366.24.9e-21155247699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     +++  l+++rl +p +f +++g++k ++k++ l +e+grsW++ l ++k++ r++ ++GW++F++ang+ +g   +Fkl++ +++ +v++++r 
  Csa17g034220.1 155 VTAWGLSNDRLNIPLPFGRSNGLNKMRGKKIYLHNEEGRSWKLSLEHDKTGIRTYVKSGWRRFCDANGISQGQKHTFKLVR-RSAPPVIRLCRP 247
                     6777899************************************************************************98.67779*999985 PP

3B365.76.8e-21270360698
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++l++++l+lp++f++ hg++k++s  ++l++e+g +W + l+++k+ + ++l+kGW +F++ ng+k+gD++ Fkl+g + +e+v++++ 
  Csa17g034220.1 270 VSPSSLSNDQLYLPRSFVSLHGLEKRCS-VIILKNEQGSKWPLVLKHTKSINLTYLKKGWTSFCDFNGIKVGDSFKFKLSG-TWEEPVLSLCP 360
                     67899999****************9998.999*************99999999**************************98.77788998886 PP

4B365.67.4e-21448539799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++ +l+s+r ++p +fa+ +g++k + k++ l +e+grsW++ l ++k++ +++l++GW++F++ang+ +g   +Fkl++ +++ +v++++r+
  Csa17g034220.1 448 SAWALRSDRQYIPITFARFNGLNKMRCKKIYLHNEEGRSWKLGLEHDKTGMHTYLRSGWRRFCSANGISQGQQHTFKLVR-KSAPPVIRLYRS 539
                     5678899**********************************************************************998.888899999875 PP

5B363.53.3e-205666501098
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +l++++ +lp++f+ ++g++k++s +++l++e+g +W + l  + ++++++l+kGW++F++ n++k+gD++ Fkl+g + +e+v++++ 
  Csa17g034220.1 566 SLSNDLQYLPRNFVISNGLDKRCS-EIVLKNEEGIKWPLVL--KHYKSATYLKKGWSSFCQVNRIKAGDSFKFKLVG-TWKEPVLSLCP 650
                     6788999**************998.****************..999999**************************99.78888999886 PP

6B367.32.1e-21743826690
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++l+++rl+lp +f +++g++k ++k+++l +e+grsW+++l+y+k + +++ ++GWk+F++ang+ +g   +Fkl++r ++
  Csa17g034220.1 743 VTASSLRNDRLYLPLSFERSNGLDKMSGKKIVLLNEEGRSWKLNLSYNKAGMHTYVRSGWKSFCDANGMSQGQQYTFKLVRR-TA 826
                     68899*************************************************************************9985.44 PP

7B363.92.6e-20854943697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++++l+++ l+l ++f++++g++k ++ ++tl++e+gr+W++ l++  + + +++++GW +F+++ngLk++D++ Fkl++ +++++ ++++
  Csa17g034220.1 854 VSASSLNKDKLYLWRSFVSSNGLDKGCN-KMTLKNEWGREWTLVLKHYESIRFTIIKRGWTSFCQDNGLKARDSFKFKLVE-TGENPILSLC 943
                     5678889999**************9886.****************99999999*************************998.6777888777 PP

8B360.72.4e-1910191115199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3    1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93  
                      f++ +++ +++ ++ l lp+ f++ +g++k  ++++tl  ++g  W v l  +kk g++ ++kGWk+F++a+g+k+g++++++l++++e+++v
  Csa17g034220.1 1019 FVTLTLTQSAFHNSKLFLPRGFTKVNGINK--PRKITLLGQDGVIWVVDLYQEKKCGTMRFGKGWKQFCEAQGVKVGESFMLELIWEDEASPV 1109
                      667778899999999********9999995..558***************66888888********************************9** PP

                      EEEE-S CS
              B3   94 vkvfrk 99  
                      +k++ k
  Csa17g034220.1 1110 LKFCTK 1115
                      **9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.9E-219106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-1910111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.32311104IPR003340B3 DNA binding domain
CDDcd100174.23E-151299No hitNo description
SMARTSM010198.3E-2314104IPR003340B3 DNA binding domain
PfamPF023622.6E-102196IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.9E-17143245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-15144245IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.057150248IPR003340B3 DNA binding domain
SMARTSM010192.9E-23151248IPR003340B3 DNA binding domain
PfamPF023626.7E-19155246IPR003340B3 DNA binding domain
CDDcd100174.08E-13160246No hitNo description
Gene3DG3DSA:2.40.330.103.1E-20257360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20261361IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.987265361IPR003340B3 DNA binding domain
CDDcd100173.47E-17265350No hitNo description
SMARTSM010191.4E-23266362IPR003340B3 DNA binding domain
PfamPF023624.5E-20270360IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-16435534IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-15438542IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.142442540IPR003340B3 DNA binding domain
SMARTSM010192.2E-23443540IPR003340B3 DNA binding domain
PfamPF023628.2E-19447539IPR003340B3 DNA binding domain
CDDcd100173.97E-13452538No hitNo description
Gene3DG3DSA:2.40.330.106.5E-19550651IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-18553655IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.521557651IPR003340B3 DNA binding domain
SMARTSM010197.4E-25558652IPR003340B3 DNA binding domain
PfamPF023622.3E-18565650IPR003340B3 DNA binding domain
CDDcd100173.83E-14573640No hitNo description
Gene3DG3DSA:2.40.330.102.7E-18731830IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.82E-17734832IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.79738836IPR003340B3 DNA binding domain
CDDcd100171.20E-15738825No hitNo description
SMARTSM010192.5E-26739836IPR003340B3 DNA binding domain
PfamPF023623.4E-20743831IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-19842944IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-19844947IPR015300DNA-binding pseudobarrel domain
CDDcd100172.53E-18849944No hitNo description
PROSITE profilePS5086313.281849945IPR003340B3 DNA binding domain
SMARTSM010195.1E-27850946IPR003340B3 DNA binding domain
PfamPF023628.0E-20854944IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-1910121114IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-2010161114IPR015300DNA-binding pseudobarrel domain
CDDcd100172.01E-1410181104No hitNo description
PfamPF023621.5E-1810191115IPR003340B3 DNA binding domain
SMARTSM010195.1E-2210191116IPR003340B3 DNA binding domain
PROSITE profilePS5086313.78910191116IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1120 aa     Download sequence    Send to blast
MADQSLHSPI KPHFFKPLLP GFRTHLDIPV AFFSKYVEGR NDQNKTAKLR SDASGITWLV  60
KMDGLKLTDG WEDFASAHDL RTGDIVVFRH EGEMVFHVTA LGPSCCEIQY TSSSSHNIND  120
DDQTNTVSRN GSRVKKNPRK KVESSSNHSR FVANVTAWGL SNDRLNIPLP FGRSNGLNKM  180
RGKKIYLHNE EGRSWKLSLE HDKTGIRTYV KSGWRRFCDA NGISQGQKHT FKLVRRSAPP  240
VIRLCRPKSR PKQRSESESP SDHSCFEGSV SPSSLSNDQL YLPRSFVSLH GLEKRCSVII  300
LKNEQGSKWP LVLKHTKSIN LTYLKKGWTS FCDFNGIKVG DSFKFKLSGT WEEPVLSLCP  360
AEANRAKTPL KCSEGSDDIN PEESEEDKNI SQECLEIKKR KYRSRCRASV ENMDDDQTNI  420
GKSSRVKKNP RKKVESSSNH SRFVAKVSAW ALRSDRQYIP ITFARFNGLN KMRCKKIYLH  480
NEEGRSWKLG LEHDKTGMHT YLRSGWRRFC SANGISQGQQ HTFKLVRKSA PPVIRLYRSK  540
PKPKQTSETE SASDNSCFEG FVDPLSLSND LQYLPRNFVI SNGLDKRCSE IVLKNEEGIK  600
WPLVLKHYKS ATYLKKGWSS FCQVNRIKAG DSFKFKLVGT WKEPVLSLCP TESNREKNPS  660
KCSGGSDDVK PEESEEESNE DKNISQHCLG IKKRKYQSRC KASVENMDDD QTNIVTGNSS  720
RVKKSPRKTV ESSSDHLSFV GNVTASSLRN DRLYLPLSFE RSNGLDKMSG KKIVLLNEEG  780
RSWKLNLSYN KAGMHTYVRS GWKSFCDANG MSQGQQYTFK LVRRTAPPVL RLYLAKHRPK  840
PESSSQHSYF VGSVSASSLN KDKLYLWRSF VSSNGLDKGC NKMTLKNEWG REWTLVLKHY  900
ESIRFTIIKR GWTSFCQDNG LKARDSFKFK LVETGENPIL SLCPADSNRD KTPLEYAKGI  960
DNVKSLSSSP SSGDDSSRSK KSEDESIEDK NISQDCLEIK KRKYCLNCRA SSSYTPNRFV  1020
TLTLTQSAFH NSKLFLPRGF TKVNGINKPR KITLLGQDGV IWVVDLYQEK KCGTMRFGKG  1080
WKQFCEAQGV KVGESFMLEL IWEDEASPVL KFCTKVNSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477828.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X1
SwissprotQ84WP30.0REM17_ARATH; B3 domain-containing protein REM17
TrEMBLR0GPB90.0R0GPB9_9BRAS; Uncharacterized protein
STRINGscaffold_102864.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.10.0B3 family protein